PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0044s0146.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 176aa    MW: 20060.9 Da    PI: 4.8381
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0044s0146.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.21.2e-31112170159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDg++WrKYG+K+vk+s++pr+YY+C+ ++Cpvkk+ver++edp++v++tYeg Hnh 
  Kalax.0044s0146.1.p 112 LDDGFKWRKYGKKMVKNSPNPRNYYKCSVEECPVKKRVERDREDPRYVITTYEGVHNHM 170
                          59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-3399172IPR003657WRKY domain
SuperFamilySSF1182905.75E-28105172IPR003657WRKY domain
PROSITE profilePS5081130.848107172IPR003657WRKY domain
SMARTSM007741.4E-35112171IPR003657WRKY domain
PfamPF031061.6E-24113169IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MDGNSSDYHN QNMHMSFGSL DCGEVSHAIF ANNEFREDLL DDWFNESGES EVTGQDLGLQ  60
DPVHQMNQVN GLEVNYNAQD EEPDTRESGG RTGRAPVQSK VAFKTKSEIE ILDDGFKWRK  120
YGKKMVKNSP NPRNYYKCSV EECPVKKRVE RDREDPRYVI TTYEGVHNHM SPSGY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-25102173778Probable WRKY transcription factor 4
2lex_A1e-25102173778Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00531DAPTransfer from AT5G26170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279407.11e-48PREDICTED: probable WRKY transcription factor 50
RefseqXP_008445519.11e-48PREDICTED: probable WRKY transcription factor 50
RefseqXP_015884439.11e-48PREDICTED: probable WRKY transcription factor 50
SwissprotQ8VWQ53e-45WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLA5AQ487e-49A5AQ48_VITVI; Putative uncharacterized protein
STRINGVIT_04s0008g01470.t014e-48(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.12e-46WRKY DNA-binding protein 50